Buy LL-37 5mg (CAP-18) for Antimicrobial & Tissue Regeneration Research
What is LL-37 (CAP-18)?
LL-37 (also known as CAP-18) is a cationic antimicrobial peptide derived from the human cathelicidin family, extensively studied for its role in innate immune defense, tissue repair, and inflammation modulation.
This peptide is the only known human cathelicidin and is produced by epithelial cells and immune cells such as neutrophils.
Researchers use LL-37 5mg to explore infection control mechanisms, epithelial regeneration, and wound healing responses in both in vitro and in vivo models.
How Does LL-37 (CAP-18) Work?
LL-37 exerts multiple biological actions across diverse cell types. Research indicates it:
-
Disrupts microbial membranes, exhibiting broad-spectrum antibacterial, antifungal, and antiviral activity.
-
Modulates immune cell signaling, influencing cytokine production and inflammation resolution.
-
Stimulates angiogenesis and collagen synthesis, promoting tissue repair and regeneration.
-
Supports epithelial defense in the respiratory, gastrointestinal, and dermal systems.
Because of these multifaceted properties, LL-37 is a valuable peptide in infection, immunity, and wound healing research.
Key Benefits of LL-37 5mg (CAP-18) for Research
-
Potent antimicrobial properties against bacteria, fungi, and viruses
-
Enhances tissue regeneration and collagen remodeling
-
Regulates immune response and inflammation
-
Supports skin and mucosal defense studies
-
Explored for chronic wound and infection model research
This peptide is intended strictly for laboratory research and not for human or clinical use.
Product Details and Specifications
-
Product Name: LL-37 (CAP-18)
-
Synonyms: Human Cathelicidin LL-37, CAP-18 peptide
-
Form: Lyophilized powder
-
Quantity: 5mg per vial
-
Purity: ≥ 99% (HPLC verified)
-
Sequence: [LL-37, 37 aa]
-
Molecular Weight: ~4493.3 Da
-
Storage: Store at -20°C; protect from light and moisture
Each vial undergoes strict analytical testing (HPLC and MS verification) to ensure structural integrity and reproducibility in research settings.
Handling and Reconstitution Guidelines
-
Reconstitution: Use sterile water for injection (WFI) or appropriate buffer.
-
Recommended Concentration: 0.1–1 mg/mL depending on assay design.
-
Storage After Reconstitution: Store aliquots at -20°C and avoid repeated freeze-thaw cycles.
Handle peptides under aseptic conditions in a sterile laboratory environment.
Mechanisms Under Investigation
LL-37 is currently being explored in studies related to:
-
Innate immune modulation and inflammation control
-
Wound healing and skin regeneration
-
Biofilm disruption and chronic infection prevention
-
Antiviral and antifungal immune responses
-
Anti-inflammatory and angiogenic signaling pathways
Applications of LL-37 in Research
-
Dermatology research: Skin regeneration and chronic wound healing
-
Microbiology: Broad-spectrum antimicrobial peptide studies
-
Immunology: Innate immunity and host defense mechanism analysis
-
Tissue engineering: Collagen and extracellular matrix modeling
-
Respiratory research: Inflammation and infection control studies
Safety & Precautions
-
For research use only — not for human or veterinary administration.
-
Avoid contact with skin and eyes.
-
Use appropriate PPE (gloves, lab coat, goggles) during handling.
-
Dispose of peptide materials according to institutional safety protocols.
Quality Assurance & Testing
Every batch of LL-37 5mg (CAP-18) is validated through:
-
HPLC purification (>99%)
-
Mass spectrometry (MS) confirmation
-
Endotoxin-free certification
-
COA and MSDS documentation available upon request
Manufactured under GMP and ISO 9001 standards, ensuring consistency, purity, and reproducibility.
Why Researchers Choose Peptide Online Store for LL-37 (CAP-18)
-
High-purity research-grade peptides
-
Third-party quality verification
-
Fast, discreet international shipping
-
Secure temperature-stable packaging
-
Expert technical support for reconstitution and handling guidance
Shipping & Delivery
-
Processing Time: Orders processed within 24–48 hours
-
Shipping: Global express delivery (typically 5–10 business days)
-
Packaging: Sealed vials in temperature-controlled materials
-
Documentation: Batch COA and purity report included upon request
How to Order LL-37 5mg (CAP-18)
-
Visit PeptideOnlineStore.eu
-
Search for LL-37 5mg (CAP-18)
-
Add to cart and proceed to secure checkout
-
Choose preferred shipping option
-
Receive order confirmation and tracking within 24 hours
Frequently Asked Questions (FAQ)
Q1: What is LL-37 used for in research?
A: It’s widely studied for antimicrobial, wound healing, and immune regulation applications.
Q2: Is LL-37 a natural peptide?
A: Yes, LL-37 is a naturally occurring human peptide from the cathelicidin family.
Q3: Can LL-37 be used in topical formulations?
A: Only in laboratory-based or preclinical research, not for human use.
Q4: Does Peptide Online Store supply COAs?
A: Yes, all LL-37 batches are shipped with Certificates of Analysis confirming identity and purity.
Related Research Peptides
-
Thymosin Beta-4 (TB-500) 5mg – Tissue repair and wound healing research
-
BPC-157 5mg – Regeneration and recovery peptide
-
GHK-Cu 50mg (Topical) – Collagen synthesis and skin repair
-
Epitalon 10mg – Cellular aging and telomere research
Final Summary
LL-37 5mg (CAP-18) is a multi-functional antimicrobial peptide integral to human immune defense and tissue healing mechanisms.
Its unique biological versatility makes it an indispensable compound in studies focusing on wound regeneration, antimicrobial resistance, and immunomodulation.
When sourced from Peptide Online Store, researchers gain access to ultra-pure, rigorously tested peptides that meet the highest standards of reliability, safety, and research precision.


Reviews
There are no reviews yet.